| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) ![]() fold elaborated with additional structures automatically mapped to Pfam PF02570 |
| Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins) |
| Protein automated matches [190963] (2 species) not a true protein |
| Species Brucella abortus [TaxId:235] [188583] (1 PDB entry) |
| Domain d3e7da_: 3e7d A: [174715] automated match to d1f2va_ |
PDB Entry: 3e7d (more details), 1.8 Å
SCOPe Domain Sequences for d3e7da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e7da_ c.23.17.1 (A:) automated matches {Brucella abortus [TaxId: 235]}
yirdgqaiydrsfaiiraeadlrhipadleklavrvihacgmvdvandlafsegagkagr
nallagapilcdarmvaegitrsrlpadnrviytlsdpsvpelakkigntrsaaaldlwl
phiegsivaignaptalfrlfelldagapkpaliigmpvgfvgaaeskdelaansrgvpy
vivrgrrggsamtaaavnalas
Timeline for d3e7da_: