SCOPe 2.06: Domain d3e6re_: 3e6r E:

Lineage for d3e6re_ (3e6r E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Non-hem ferritin [63524] (7 species)

7. Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)

8. Domain d3e6re_: 3e6r E: [174699]
   automated match to d1vlga_
   complexed with so4

Details for d3e6re_

PDB Entry: 3e6r, 2.4 Å

PDB Description: crystal structure of apo-ferritin from pseudo-nitzschia multiseries

PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d3e6re_:

Sequence; same for both SEQRES and ATOM records:

>d3e6re_ a.25.1.1 (E:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvs

Timeline for d3e6re_:

• d3e6re_ first appeared in SCOPe 2.01
  
• d3e6re_ appears in SCOPe 2.05
  
• d3e6re_ appears in SCOPe 2.07
  
• d3e6re_ appears in the current release, SCOPe 2.08