Lineage for d3e6kb_ (3e6k B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991013Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 991014Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 991015Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 991036Protein Arginase [52770] (5 species)
  7. 991068Species Human (Homo sapiens) [TaxId:9606] [142346] (22 PDB entries)
    Uniprot P05089 5-313
  8. 991105Domain d3e6kb_: 3e6k B: [174694]
    automated match to d1wvaa1
    complexed with abh, mn; mutant

Details for d3e6kb_

PDB Entry: 3e6k (more details), 2.1 Å

PDB Description: x-ray structure of human arginase i: the mutant d183a in complex with abh
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d3e6kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6kb_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvapg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhk

SCOPe Domain Coordinates for d3e6kb_:

Click to download the PDB-style file with coordinates for d3e6kb_.
(The format of our PDB-style files is described here.)

Timeline for d3e6kb_: