SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3e6ka_ (3e6k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115344Protein Arginase [52770] (5 species)
  7. 2115376Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
    Uniprot P05089 5-313
  8. 2115419Domain d3e6ka_: 3e6k A: [174693]
    automated match to d1wvaa1
    complexed with abh, mn; mutant

Details for d3e6ka_

PDB Entry: 3e6k (more details), 2.1 Å

PDB Description: X-ray structure of Human Arginase I: the mutant D183A in complex with ABH
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d3e6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6ka_ c.42.1.1 (A:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvapg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhk

SCOPe Domain Coordinates for d3e6ka_:

Click to download the PDB-style file with coordinates for d3e6ka_.
(The format of our PDB-style files is described here.)

Timeline for d3e6ka_: