Lineage for d3e6gd_ (3e6g D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2133041Species Xanthomonas oryzae [TaxId:64187] [188962] (1 PDB entry)
  8. 2133045Domain d3e6gd_: 3e6g D: [174691]
    automated match to d1y4ia1

Details for d3e6gd_

PDB Entry: 3e6g (more details), 2.8 Å

PDB Description: Crystal structure of XometC, a cystathionine c-lyase-like protein from Xanthomonas oryzae pv.oryzae
PDB Compounds: (D:) Cystathionine gamma-lyase-like protein

SCOPe Domain Sequences for d3e6gd_:

Sequence, based on SEQRES records: (download)

>d3e6gd_ c.67.1.0 (D:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
rlsvgiedlgdlrgdlera

Sequence, based on observed residues (ATOM records): (download)

>d3e6gd_ c.67.1.0 (D:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
alslatlaihgthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamd
dlyggtfrlfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdia
aiaviarkhglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdna
elaeqmaflqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekvi
ypglashpqhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnh
pavmtreqlgisdalvrlsvgiedlgdlrgdlera

SCOPe Domain Coordinates for d3e6gd_:

Click to download the PDB-style file with coordinates for d3e6gd_.
(The format of our PDB-style files is described here.)

Timeline for d3e6gd_: