| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein) automatically mapped to Pfam PF01340 |
| Protein Met repressor, MetJ (MetR) [47607] (1 species) |
| Species Escherichia coli [TaxId:562] [47608] (10 PDB entries) |
| Domain d1mjod_: 1mjo D: [17469] protein/DNA complex; complexed with ca, sam; mutant |
PDB Entry: 1mjo (more details), 2.1 Å
SCOPe Domain Sequences for d1mjod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjod_ a.43.1.5 (D:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
Timeline for d1mjod_: