SCOPe 2.03: Domain d3e62a_: 3e62 A:

Lineage for d3e62a_ (3e62 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)

8. Domain d3e62a_: 3e62 A: [174684]
   automated match to d1u46a_
   complexed with 5b1

Details for d3e62a_

PDB Entry: 3e62, 1.92 Å

PDB Description: Fragment based discovery of JAK-2 inhibitors

PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d3e62a_:

Sequence; same for both SEQRES and ATOM records:

>d3e62a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfere
ieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqyts
qickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespi
fwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhl
iellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma

Timeline for d3e62a_:

• d3e62a_ first appeared in SCOPe 2.01
  
• d3e62a_ appears in SCOPe 2.02
  
• d3e62a_ appears in SCOPe 2.04
  
• d3e62a_ appears in the current release, SCOPe 2.08