| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein automated matches [190406] (19 species) not a true protein |
| Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries) |
| Domain d3e5wd_: 3e5w D: [174681] automated match to d1uisa_ |
PDB Entry: 3e5w (more details), 1.71 Å
SCOPe Domain Sequences for d3e5wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e5wd_ d.22.1.1 (D:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
slikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdilatsf
mygsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhakvt
gvnfpsngavmqkktkgwepstemlypadgglrgycqmalnvdgggylfcsfettyrskk
tdenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlpsklgrl
Timeline for d3e5wd_: