SCOPe 2.06: Domain d1mjoa_: 1mjo A:

Lineage for d1mjoa_ (1mjo A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
   automatically mapped to Pfam PF01340

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1mjoa_: 1mjo A: [17466]
   protein/DNA complex; complexed with ca, sam; mutant

Details for d1mjoa_

PDB Entry: 1mjo, 2.1 Å

PDB Description: methionine holorepressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to the minimal met consensus operator with the central ta step mutated to at

PDB Compounds: (A:) methionine repressor

SCOPe Domain Sequences for d1mjoa_:

Sequence; same for both SEQRES and ATOM records:

>d1mjoa_ a.43.1.5 (A:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1mjoa_:

• d1mjoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1mjoa_ appears in SCOPe 2.05
  
• d1mjoa_ appears in SCOPe 2.07
  
• d1mjoa_ appears in the current release, SCOPe 2.08