Lineage for d3e4dc1 (3e4d C:1-277)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2901935Species Agrobacterium tumefaciens [TaxId:176299] [188961] (3 PDB entries)
  8. 2901942Domain d3e4dc1: 3e4d C:1-277 [174649]
    Other proteins in same PDB: d3e4da2, d3e4db2, d3e4dc2, d3e4de2
    automated match to d1pv1a_
    complexed with cl, mg

Details for d3e4dc1

PDB Entry: 3e4d (more details), 2.01 Å

PDB Description: structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens
PDB Compounds: (C:) Esterase D

SCOPe Domain Sequences for d3e4dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e4dc1 c.69.1.0 (C:1-277) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanvm
ekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmys
yvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssad
wsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeaik
gtdigltlrmhdrydhsyyfistfmddhlkwhaerlg

SCOPe Domain Coordinates for d3e4dc1:

Click to download the PDB-style file with coordinates for d3e4dc1.
(The format of our PDB-style files is described here.)

Timeline for d3e4dc1: