Lineage for d3e3ta_ (3e3t A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2388278Protein Elastase [50536] (4 species)
  7. 2388296Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)
  8. 2388319Domain d3e3ta_: 3e3t A: [174632]
    automated match to d1b0ea_
    complexed with i3c, iod, na, so4

Details for d3e3ta_

PDB Entry: 3e3t (more details), 1.6 Å

PDB Description: Structure of porcine pancreatic elastase with the magic triangle I3C
PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d3e3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e3ta_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d3e3ta_:

Click to download the PDB-style file with coordinates for d3e3ta_.
(The format of our PDB-style files is described here.)

Timeline for d3e3ta_: