SCOP 1.57: Domain d1cmcb_: 1cmc B:

Lineage for d1cmcb_ (1cmc B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.43: Met repressor-like [47597] (1 superfamily)

4. Superfamily a.43.1: Met repressor-like [47598] (2 families)

5. Family a.43.1.2: Bacterial repressors [47604] (2 proteins)

6. Protein Met repressor, MetR [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1cmcb_: 1cmc B: [17463]

Details for d1cmcb_

PDB Entry: 1cmc, 1.8 Å

PDB Description: three dimensional crystal structures of e. coli met repressor with and without corepressor

SCOP Domain Sequences for d1cmcb_:

Sequence; same for both SEQRES and ATOM records:

>d1cmcb_ a.43.1.2 (B:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1cmcb_:

• d1cmcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmcb_ appears in SCOP 1.59
  
• d1cmcb_ appears in the current release, SCOPe 2.08