Lineage for d3e3qe_ (3e3q E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931803Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)
  8. 931846Domain d3e3qe_: 3e3q E: [174625]
    automated match to d2icwj1
    mutant

Details for d3e3qe_

PDB Entry: 3e3q (more details), 2.95 Å

PDB Description: structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
PDB Compounds: (E:) TCR beta chain

SCOPe Domain Sequences for d3e3qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e3qe_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls

SCOPe Domain Coordinates for d3e3qe_:

Click to download the PDB-style file with coordinates for d3e3qe_.
(The format of our PDB-style files is described here.)

Timeline for d3e3qe_: