SCOPe 2.01: Domain d3e3qa_: 3e3q a:

Lineage for d3e3qa_ (3e3q a:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)

8. Domain d3e3qa_: 3e3q a: [174624]
   automated match to d2icwj1
   mutant

Details for d3e3qa_

PDB Entry: 3e3q, 2.95 Å

PDB Description: structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9

PDB Compounds: (a:) TCR beta chain

SCOPe Domain Sequences for d3e3qa_:

Sequence; same for both SEQRES and ATOM records:

>d3e3qa_ b.1.1.1 (a:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls

Timeline for d3e3qa_:

• d3e3qa_ is new in SCOPe 2.01-stable
  
• d3e3qa_ appears in SCOPe 2.02
  
• d3e3qa_ appears in the current release, SCOPe 2.08