Lineage for d3e3ob_ (3e3o B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007198Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1007199Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1007251Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 proteins)
  6. 1007380Protein automated matches [190111] (3 species)
    not a true protein
  7. 1007396Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [187274] (90 PDB entries)
  8. 1007487Domain d3e3ob_: 3e3o B: [174621]
    automated match to d1e1ya_
    complexed with imp, so4

Details for d3e3ob_

PDB Entry: 3e3o (more details), 2.6 Å

PDB Description: glycogen phosphorylase r state-imp complex
PDB Compounds: (B:) Glycogen phosphorylase, muscle form

SCOPe Domain Sequences for d3e3ob_:

Sequence, based on SEQRES records: (download)

>d3e3ob_ c.87.1.4 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
kapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqd
iirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawe
vtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlr
rmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngi
tprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfa
aylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmig
gkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqi
stagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgy
naqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqer
vsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap

Sequence, based on observed residues (ATOM records): (download)

>d3e3ob_ c.87.1.4 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
kapndfvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkssktn
fdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipeale
rwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlc
iagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiae
rigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdv
qvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklita
igdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlng
altigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieql
ssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirni
atsgkfssdrtiaqyareiwgvepsrqrlpap

SCOPe Domain Coordinates for d3e3ob_:

Click to download the PDB-style file with coordinates for d3e3ob_.
(The format of our PDB-style files is described here.)

Timeline for d3e3ob_: