SCOPe 2.07: Domain d1cmca_: 1cmc A:

Lineage for d1cmca_ (1cmc A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
   automatically mapped to Pfam PF01340

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1cmca_: 1cmc A: [17462]
   complexed with mg, sam

Details for d1cmca_

PDB Entry: 1cmc, 1.8 Å

PDB Description: three dimensional crystal structures of e. coli met repressor with and without corepressor

PDB Compounds: (A:) met repressor

SCOPe Domain Sequences for d1cmca_:

Sequence; same for both SEQRES and ATOM records:

>d1cmca_ a.43.1.5 (A:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1cmca_:

• d1cmca_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmca_ appears in SCOPe 2.06
  
• d1cmca_ appears in the current release, SCOPe 2.08