Class a: All alpha proteins [46456] (289 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein) automatically mapped to Pfam PF01340 |
Protein Met repressor, MetJ (MetR) [47607] (1 species) |
Species Escherichia coli [TaxId:562] [47608] (10 PDB entries) |
Domain d1cmca_: 1cmc A: [17462] complexed with mg, sam |
PDB Entry: 1cmc (more details), 1.8 Å
SCOPe Domain Sequences for d1cmca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmca_ a.43.1.5 (A:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]} aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea flhaftgqplpddadlrkersdeipeaakeimremginpetwey
Timeline for d1cmca_: