Lineage for d1cmca_ (1cmc A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
    automatically mapped to Pfam PF01340
  6. Protein Met repressor, MetJ (MetR) [47607] (1 species)
  7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. Domain d1cmca_: 1cmc A: [17462]
    complexed with mg, sam

Details for d1cmca_

PDB Entry: 1cmc (more details), 1.8 Å

PDB Description: three dimensional crystal structures of e. coli met repressor with and without corepressor
PDB Compounds: (A:) met repressor

SCOPe Domain Sequences for d1cmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmca_ a.43.1.5 (A:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOPe Domain Coordinates for d1cmca_ are not available.

Timeline for d1cmca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cmcb_