Lineage for d1cmbb_ (1cmb B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.43: Met repressor-like [47597] (1 superfamily) Superfamily a.43.1: Met repressor-like [47598] (2 families) 
Family a.43.1.2: Bacterial repressors [47604] (2 proteins) 
Protein Met repressor, MetR [47607] (1 species) Species Escherichia coli [TaxId:562] [47608] (10 PDB entries) 
Domain d1cmbb_: 1cmb B: [17461]
Details for d1cmbb_
PDB Entry: 1cmb (more details), 1.8 Å
PDB Description: three dimensional crystal structures of escherichia coli met repressor with and without corepressor
SCOP Domain Sequences for d1cmbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmbb_ a.43.1.2 (B:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
SCOP Domain Coordinates for d1cmbb_:
Click to download the PDB-style file with coordinates for d1cmbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cmbb_:
- d1cmbb_ appears in SCOP 1.57
- d1cmbb_ appears in the current release, SCOPe 2.08
View in 3D
