Lineage for d1cmbb_ (1cmb B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
    automatically mapped to Pfam PF01340
  6. Protein Met repressor, MetJ (MetR) [47607] (1 species)
  7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. Domain d1cmbb_: 1cmb B: [17461]
    complexed with po4

Details for d1cmbb_

PDB Entry: 1cmb (more details), 1.8 Å

PDB Description: three dimensional crystal structures of escherichia coli met repressor with and without corepressor
PDB Compounds: (B:) met apo-repressor

SCOPe Domain Sequences for d1cmbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmbb_ a.43.1.5 (B:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOPe Domain Coordinates for d1cmbb_ are not available.

Timeline for d1cmbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cmba_