Lineage for d3e3ig_ (3e3i G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883079Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2883111Protein automated matches [190278] (5 species)
    not a true protein
  7. 2883117Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries)
  8. 2883124Domain d3e3ig_: 3e3i G: [174602]
    automated match to d1i6oa_
    complexed with bct, so4, zn

Details for d3e3ig_

PDB Entry: 3e3i (more details), 2 Å

PDB Description: h. influenzae beta-carbonic anhydrase, variant g41a with 100 mm bicarbonate
PDB Compounds: (G:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3e3ig_:

Sequence, based on SEQRES records: (download)

>d3e3ig_ c.53.2.1 (G:) automated matches {Haemophilus influenzae [TaxId: 727]}
mdkikqlfannyswaqrmkeenstyfkeladhqtphylwiacsdsrvpaekltnlepgel
fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
ydvndgflvdqgvmatsretleisyrnaiarlsildeenil

Sequence, based on observed residues (ATOM records): (download)

>d3e3ig_ c.53.2.1 (G:) automated matches {Haemophilus influenzae [TaxId: 727]}
mdkikqlfannyswaqrmkeeladhqtphylwiacsdsrvpaekltnlepgelfvhrnva
nqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiw
fkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvydvndgf
lvdqgvmatsretleisyrnaiarlsildeenil

SCOPe Domain Coordinates for d3e3ig_:

Click to download the PDB-style file with coordinates for d3e3ig_.
(The format of our PDB-style files is described here.)

Timeline for d3e3ig_: