SCOPe 2.05: Domain d1cmba_: 1cmb A:

Lineage for d1cmba_ (1cmb A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
   automatically mapped to Pfam PF01340

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1cmba_: 1cmb A: [17460]
   complexed with po4

Details for d1cmba_

PDB Entry: 1cmb, 1.8 Å

PDB Description: three dimensional crystal structures of escherichia coli met repressor with and without corepressor

PDB Compounds: (A:) met apo-repressor

SCOPe Domain Sequences for d1cmba_:

Sequence; same for both SEQRES and ATOM records:

>d1cmba_ a.43.1.5 (A:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1cmba_:

• d1cmba_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmba_ appears in SCOPe 2.04
  
• d1cmba_ appears in SCOPe 2.06
  
• d1cmba_ appears in the current release, SCOPe 2.08