Lineage for d3e3ic_ (3e3i C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857121Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857166Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1857167Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 1857199Protein automated matches [190278] (5 species)
    not a true protein
  7. 1857205Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries)
  8. 1857208Domain d3e3ic_: 3e3i C: [174598]
    automated match to d1i6oa_
    complexed with bct, so4, zn

Details for d3e3ic_

PDB Entry: 3e3i (more details), 2 Å

PDB Description: h. influenzae beta-carbonic anhydrase, variant g41a with 100 mm bicarbonate
PDB Compounds: (C:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3e3ic_:

Sequence, based on SEQRES records: (download)

>d3e3ic_ c.53.2.1 (C:) automated matches {Haemophilus influenzae [TaxId: 727]}
mdkikqlfannyswaqrmkeenstyfkeladhqtphylwiacsdsrvpaekltnlepgel
fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
ydvndgflvdqgvmatsretleisyrnaiarlsildeeni

Sequence, based on observed residues (ATOM records): (download)

>d3e3ic_ c.53.2.1 (C:) automated matches {Haemophilus influenzae [TaxId: 727]}
mdkikqlfannyswaqrmkeetphylwiacsdsrvpaekltnlepgelfvhrnvanqvih
tdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhgh
llgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvydvndgflvdqg
vmatsretleisyrnaiarlsildeeni

SCOPe Domain Coordinates for d3e3ic_:

Click to download the PDB-style file with coordinates for d3e3ic_.
(The format of our PDB-style files is described here.)

Timeline for d3e3ic_: