SCOPe 2.04: Domain d1b01b_: 1b01 B:

Lineage for d1b01b_ (1b01 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.3: CopG-like [100970] (4 proteins)
   similar to the phage repressor family

6. Protein Transcriptional repressor CopG [47605] (1 species)
   plasmid-encoded

7. Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)

8. Domain d1b01b_: 1b01 B: [17459]
   protein/DNA complex

Details for d1b01b_

PDB Entry: 1b01, 2.56 Å

PDB Description: transcriptional repressor copg/dna complex

PDB Compounds: (B:) transcriptional repressor copg

SCOPe Domain Sequences for d1b01b_:

Sequence; same for both SEQRES and ATOM records:

>d1b01b_ a.43.1.3 (B:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgq

Timeline for d1b01b_:

• d1b01b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b01b_ appears in SCOPe 2.03
  
• d1b01b_ appears in SCOPe 2.05
  
• d1b01b_ appears in the current release, SCOPe 2.08