Lineage for d1b01b_ (1b01 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270289Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1270290Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1270333Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 1270369Protein Transcriptional repressor CopG [47605] (1 species)
    plasmid-encoded
  7. 1270370Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)
  8. 1270375Domain d1b01b_: 1b01 B: [17459]
    protein/DNA complex

Details for d1b01b_

PDB Entry: 1b01 (more details), 2.56 Å

PDB Description: transcriptional repressor copg/dna complex
PDB Compounds: (B:) transcriptional repressor copg

SCOPe Domain Sequences for d1b01b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b01b_ a.43.1.3 (B:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgq

SCOPe Domain Coordinates for d1b01b_:

Click to download the PDB-style file with coordinates for d1b01b_.
(The format of our PDB-style files is described here.)

Timeline for d1b01b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b01a_