Class a: All alpha proteins [46456] (284 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.3: CopG-like [100970] (4 proteins) similar to the phage repressor family |
Protein Transcriptional repressor CopG [47605] (1 species) plasmid-encoded |
Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries) |
Domain d1b01a_: 1b01 A: [17458] protein/DNA complex |
PDB Entry: 1b01 (more details), 2.56 Å
SCOPe Domain Sequences for d1b01a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b01a_ a.43.1.3 (A:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]} mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
Timeline for d1b01a_: