SCOPe 2.01: Domain d3e2ya_: 3e2y A:

Lineage for d3e2ya_ (3e2y A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (25 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188700] (4 PDB entries)

8. Domain d3e2ya_: 3e2y A: [174578]
   automated match to d1w7la_
   complexed with gln, gol, pmp

Details for d3e2ya_

PDB Entry: 3e2y, 2.26 Å

PDB Description: crystal structure of mouse kynurenine aminotransferase iii in complex with glutamine

PDB Compounds: (A:) Kynurenine-oxoglutarate transaminase 3

SCOPe Domain Sequences for d3e2ya_:

Sequence; same for both SEQRES and ATOM records:

>d3e2ya_ c.67.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn

Timeline for d3e2ya_:

• d3e2ya_ is new in SCOPe 2.01-stable
  
• d3e2ya_ appears in SCOPe 2.02
  
• d3e2ya_ appears in the current release, SCOPe 2.08