Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
Protein automated matches [190278] (5 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries) |
Domain d3e2xb_: 3e2x B: [174577] automated match to d1i6ob_ complexed with so4, zn |
PDB Entry: 3e2x (more details), 2.55 Å
SCOPe Domain Sequences for d3e2xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e2xb_ c.53.2.1 (B:) automated matches {Haemophilus influenzae [TaxId: 727]} tphylwigcsdsrapaekltnlepgelfvhrnvanqvihtdfnclsvvqyavdvlkiehi iicghtncggihaamadkdlglinnwllhirdiwfkhghllgklspekradmltkinvae qvynlgrtsivksawergqklslhgwvydvndgflvdqgvmatsretleisyrnaiarls ildeen
Timeline for d3e2xb_: