Lineage for d2cpgb_ (2cpg B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3623Family a.43.1.2: Bacterial repressors [47604] (2 proteins)
  6. 3656Protein Transcriptional repressor CopG [47605] (1 species)
  7. 3657Species Streptococcus agalactiae [TaxId:1311] [47606] (2 PDB entries)
  8. 3659Domain d2cpgb_: 2cpg B: [17456]

Details for d2cpgb_

PDB Entry: 2cpg (more details), 1.6 Å

PDB Description: transcriptional repressor copg

SCOP Domain Sequences for d2cpgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpgb_ a.43.1.2 (B:) Transcriptional repressor CopG {Streptococcus agalactiae}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgqer

SCOP Domain Coordinates for d2cpgb_:

Click to download the PDB-style file with coordinates for d2cpgb_.
(The format of our PDB-style files is described here.)

Timeline for d2cpgb_: