SCOPe 2.06: Domain d3e29c_: 3e29 C:

Lineage for d3e29c_ (3e29 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (36 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [188610] (1 PDB entry)

8. Domain d3e29c_: 3e29 C: [174553]
   automated match to d2f0xa1

Details for d3e29c_

PDB Entry: 3e29, 2.4 Å

PDB Description: x-ray structure of the protein q7we92_borbr from thioesterase superfamily. northeast structural genomics consortium target bor214a.

PDB Compounds: (C:) uncharacterized protein Q7WE92_BORBR

SCOPe Domain Sequences for d3e29c_:

Sequence; same for both SEQRES and ATOM records:

>d3e29c_ d.38.1.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
sstalemasrfvnrspfnrwlgmsvleageqgivlgikwreelisspeirsthggilatl
vdaagdyavalktghpvptmdmhvdyhrvatpgdlraegqvihfgkrfataharvldmdg
nlvasgralylir

Timeline for d3e29c_:

• d3e29c_ first appeared in SCOPe 2.01
  
• d3e29c_ appears in SCOPe 2.05
  
• d3e29c_ appears in SCOPe 2.07
  
• d3e29c_ appears in the current release, SCOPe 2.08