Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (36 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [188610] (1 PDB entry) |
Domain d3e29c_: 3e29 C: [174553] automated match to d2f0xa1 |
PDB Entry: 3e29 (more details), 2.4 Å
SCOPe Domain Sequences for d3e29c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e29c_ d.38.1.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]} sstalemasrfvnrspfnrwlgmsvleageqgivlgikwreelisspeirsthggilatl vdaagdyavalktghpvptmdmhvdyhrvatpgdlraegqvihfgkrfataharvldmdg nlvasgralylir
Timeline for d3e29c_: