SCOPe 2.06: Domain d2cpga_: 2cpg A:

Lineage for d2cpga_ (2cpg A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.3: CopG-like [100970] (4 proteins)
   similar to the phage repressor family

6. Protein Transcriptional repressor CopG [47605] (1 species)
   plasmid-encoded

7. Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)

8. Domain d2cpga_: 2cpg A: [17455]
   complexed with cl

Details for d2cpga_

PDB Entry: 2cpg, 1.6 Å

PDB Description: transcriptional repressor copg

PDB Compounds: (A:) transcriptional repressor copg

SCOPe Domain Sequences for d2cpga_:

Sequence; same for both SEQRES and ATOM records:

>d2cpga_ a.43.1.3 (A:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgq

Timeline for d2cpga_:

• d2cpga_ first appeared (with stable ids) in SCOP 1.55
  
• d2cpga_ appears in SCOPe 2.05
  
• d2cpga_ appears in SCOPe 2.07
  
• d2cpga_ appears in the current release, SCOPe 2.08