Lineage for d2cpga_ (2cpg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712633Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 2712666Protein Transcriptional repressor CopG [47605] (1 species)
    plasmid-encoded
  7. 2712667Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)
  8. 2712668Domain d2cpga_: 2cpg A: [17455]
    complexed with cl

Details for d2cpga_

PDB Entry: 2cpg (more details), 1.6 Å

PDB Description: transcriptional repressor copg
PDB Compounds: (A:) transcriptional repressor copg

SCOPe Domain Sequences for d2cpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpga_ a.43.1.3 (A:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgq

SCOPe Domain Coordinates for d2cpga_:

Click to download the PDB-style file with coordinates for d2cpga_.
(The format of our PDB-style files is described here.)

Timeline for d2cpga_: