Lineage for d3e27a_ (3e27 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860573Protein automated matches [190964] (6 species)
    not a true protein
  7. 2860574Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries)
  8. 2860581Domain d3e27a_: 3e27 A: [174541]
    automated match to d1kama_
    complexed with dnd, mg

Details for d3e27a_

PDB Entry: 3e27 (more details), 2.2 Å

PDB Description: Nicotinic acid mononucleotide (NaMN) adenylyltransferase from Bacillus anthracis: product complex
PDB Compounds: (A:) Nicotinate (Nicotinamide) nucleotide adenylyltransferase

SCOPe Domain Sequences for d3e27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e27a_ c.26.1.3 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
rkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrditsvesrlqmle
lateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniea
lldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyi
ernglyes

SCOPe Domain Coordinates for d3e27a_:

Click to download the PDB-style file with coordinates for d3e27a_.
(The format of our PDB-style files is described here.)

Timeline for d3e27a_: