SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3e1ql_ (3e1q L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988620Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 1988748Species Escherichia coli [TaxId:562] [47245] (11 PDB entries)
  8. 1988816Domain d3e1ql_: 3e1q L: [174532]
    automated match to d1bcfa_
    complexed with fe2, hem, so4

Details for d3e1ql_

PDB Entry: 3e1q (more details), 2.6 Å

PDB Description: Crystal structure of W133F variant E. coli Bacterioferritn with iron.
PDB Compounds: (L:) bacterioferritin

SCOPe Domain Sequences for d3e1ql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1ql_ a.25.1.1 (L:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidfleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3e1ql_:

Click to download the PDB-style file with coordinates for d3e1ql_.
(The format of our PDB-style files is described here.)

Timeline for d3e1ql_: