Lineage for d1mnta_ (1mnt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325751Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 2325788Protein Mnt repressor [47602] (1 species)
  7. 2325789Species Salmonella bacteriophage P22 [TaxId:10754] [47603] (1 PDB entry)
  8. 2325790Domain d1mnta_: 1mnt A: [17453]
    includes 15 residues common with the tetramerization domain

Details for d1mnta_

PDB Entry: 1mnt (more details)

PDB Description: solution structure of dimeric mnt repressor (1-76)
PDB Compounds: (A:) mnt repressor

SCOPe Domain Sequences for d1mnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnta_ a.43.1.1 (A:) Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
arddphfnfrmpmevreklkfraeangrsmnsellqivqdalskpspvtgyrndaerlad
eqselv

SCOPe Domain Coordinates for d1mnta_:

Click to download the PDB-style file with coordinates for d1mnta_.
(The format of our PDB-style files is described here.)

Timeline for d1mnta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mntb_