SCOPe 2.05: Domain d1qtgb_: 1qtg B:

Lineage for d1qtgb_ (1qtg B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)

6. Protein Arc repressor [47600] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)

8. Domain d1qtgb_: 1qtg B: [17452]
   mutant

Details for d1qtgb_

PDB Entry: 1qtg

PDB Description: averaged nmr model of switch arc, a double mutant of arc repressor

PDB Compounds: (B:) arc repressor

SCOPe Domain Sequences for d1qtgb_:

Sequence; same for both SEQRES and ATOM records:

>d1qtgb_ a.43.1.1 (B:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mkgmskmpqflnrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga

Timeline for d1qtgb_:

• d1qtgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qtgb_ appears in SCOPe 2.04
  
• d1qtgb_ appears in SCOPe 2.06
  
• d1qtgb_ appears in the current release, SCOPe 2.08