Class a: All alpha proteins [46456] (289 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins) |
Protein Arc repressor [47600] (1 species) |
Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries) |
Domain d1qtga_: 1qtg A: [17451] mutant |
PDB Entry: 1qtg (more details)
SCOPe Domain Sequences for d1qtga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtga_ a.43.1.1 (A:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]} mkgmskmpqflnrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
Timeline for d1qtga_: