![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
![]() | Species Escherichia coli [TaxId:562] [47245] (11 PDB entries) |
![]() | Domain d3e1ni_: 3e1n I: [174493] automated match to d1bcfa_ complexed with fe2, hem, so4, unk |
PDB Entry: 3e1n (more details), 2.8 Å
SCOPe Domain Sequences for d3e1ni_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1ni_ a.25.1.1 (I:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqire
Timeline for d3e1ni_: