| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
| Species Escherichia coli [TaxId:562] [47245] (11 PDB entries) |
| Domain d3e1nb_: 3e1n B: [174486] automated match to d1bcfa_ complexed with fe2, hem, so4, unk |
PDB Entry: 3e1n (more details), 2.8 Å
SCOPe Domain Sequences for d3e1nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1nb_ a.25.1.1 (B:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqire
Timeline for d3e1nb_: