Lineage for d3e0of_ (3e0o F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428233Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2428234Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2428275Family b.88.1.3: SelR domain [75041] (3 proteins)
    automatically mapped to Pfam PF01641
  6. 2428280Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)
  7. 2428281Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries)
    Uniprot P54155 1-143
  8. 2428287Domain d3e0of_: 3e0o F: [174440]
    automated match to d1xm0a1

Details for d3e0of_

PDB Entry: 3e0o (more details), 2.6 Å

PDB Description: Crystal structure of MsrB
PDB Compounds: (F:) Peptide methionine sulfoxide reductase msrB

SCOPe Domain Sequences for d3e0of_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0of_ b.88.1.3 (F:) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfds
qcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaa
lrfvpkhklkeegyesylhlf

SCOPe Domain Coordinates for d3e0of_:

Click to download the PDB-style file with coordinates for d3e0of_.
(The format of our PDB-style files is described here.)

Timeline for d3e0of_: