Lineage for d1bdvd_ (1bdv D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3584Family a.43.1.1: Phage repressors [47599] (2 proteins)
  6. 3585Protein Arc repressor [47600] (1 species)
  7. 3586Species Salmonella bacteriophage p22 [TaxId:10754] [47601] (10 PDB entries)
  8. 3610Domain d1bdvd_: 1bdv D: [17444]

Details for d1bdvd_

PDB Entry: 1bdv (more details), 2.8 Å

PDB Description: arc fv10 cocrystal

SCOP Domain Sequences for d1bdvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdvd_ a.43.1.1 (D:) Arc repressor {Salmonella bacteriophage p22}
mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr

SCOP Domain Coordinates for d1bdvd_:

Click to download the PDB-style file with coordinates for d1bdvd_.
(The format of our PDB-style files is described here.)

Timeline for d1bdvd_: