Lineage for d1bdvd_ (1bdv D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712592Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 2712593Protein Arc repressor [47600] (1 species)
  7. 2712594Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 2712618Domain d1bdvd_: 1bdv D: [17444]
    protein/DNA complex

Details for d1bdvd_

PDB Entry: 1bdv (more details), 2.8 Å

PDB Description: arc fv10 cocrystal
PDB Compounds: (D:) protein (arc fv10 repressor)

SCOPe Domain Sequences for d1bdvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdvd_ a.43.1.1 (D:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr

SCOPe Domain Coordinates for d1bdvd_:

Click to download the PDB-style file with coordinates for d1bdvd_.
(The format of our PDB-style files is described here.)

Timeline for d1bdvd_: