SCOPe 2.06: Domain d3e0od_: 3e0o D:

Lineage for d3e0od_ (3e0o D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.3: SelR domain [75041] (3 proteins)
   automatically mapped to Pfam PF01641

6. Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries)
   Uniprot P54155 1-143

8. Domain d3e0od_: 3e0o D: [174438]
   automated match to d1xm0a1

Details for d3e0od_

PDB Entry: 3e0o, 2.6 Å

PDB Description: Crystal structure of MsrB

PDB Compounds: (D:) Peptide methionine sulfoxide reductase msrB

SCOPe Domain Sequences for d3e0od_:

Sequence; same for both SEQRES and ATOM records:

>d3e0od_ b.88.1.3 (D:) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
ynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfdsqc
gwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaalr
fvpkhklkeegyesylhlf

Timeline for d3e0od_:

• d3e0od_ first appeared in SCOPe 2.01
  
• d3e0od_ appears in SCOPe 2.05
  
• d3e0od_ appears in SCOPe 2.07
  
• d3e0od_ appears in the current release, SCOPe 2.08