SCOPe 2.01: Domain d3e0ob_: 3e0o B:

Lineage for d3e0ob_ (3e0o B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.88: Mss4-like [51315] (1 superfamily)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (4 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.3: SelR domain [75041] (3 proteins)

6. Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries)
   Uniprot P54155 1-143

8. Domain d3e0ob_: 3e0o B: [174436]
   automated match to d1xm0a1

Details for d3e0ob_

PDB Entry: 3e0o, 2.6 Å

PDB Description: Crystal structure of MsrB

PDB Compounds: (B:) Peptide methionine sulfoxide reductase msrB

SCOPe Domain Sequences for d3e0ob_:

Sequence; same for both SEQRES and ATOM records:

>d3e0ob_ b.88.1.3 (B:) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
mmaynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfd
sqcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsa
alrfvpkhklkeegyesylhlf

Timeline for d3e0ob_:

• d3e0ob_ is new in SCOPe 2.01-stable
  
• d3e0ob_ appears in SCOPe 2.02
  
• d3e0ob_ appears in the current release, SCOPe 2.08