Lineage for d3e0oa_ (3e0o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818899Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2818900Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2818941Family b.88.1.3: SelR domain [75041] (3 proteins)
    automatically mapped to Pfam PF01641
  6. 2818946Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)
  7. 2818947Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries)
    Uniprot P54155 1-143
  8. 2818948Domain d3e0oa_: 3e0o A: [174435]
    automated match to d1xm0a1

Details for d3e0oa_

PDB Entry: 3e0o (more details), 2.6 Å

PDB Description: Crystal structure of MsrB
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrB

SCOPe Domain Sequences for d3e0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0oa_ b.88.1.3 (A:) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
mmaynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfd
sqcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsa
alrfvpkhklkeegyesylhlf

SCOPe Domain Coordinates for d3e0oa_:

Click to download the PDB-style file with coordinates for d3e0oa_.
(The format of our PDB-style files is described here.)

Timeline for d3e0oa_: