![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (5 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.3: SelR domain [75041] (3 proteins) automatically mapped to Pfam PF01641 |
![]() | Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141671] (2 PDB entries) Uniprot P54155 1-143 |
![]() | Domain d3e0oa_: 3e0o A: [174435] automated match to d1xm0a1 |
PDB Entry: 3e0o (more details), 2.6 Å
SCOPe Domain Sequences for d3e0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e0oa_ b.88.1.3 (A:) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]} mmaynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfd sqcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsa alrfvpkhklkeegyesylhlf
Timeline for d3e0oa_: