SCOPe 2.06: Domain d3dzwb_: 3dzw B:

Lineage for d3dzwb_ (3dzw B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)

6. Protein Lectin (agglutinin) [51112] (4 species)

7. Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [51115] (2 PDB entries)

8. Domain d3dzwb_: 3dzw B: [174418]
   automated match to d1npla_
   complexed with po4

Details for d3dzwb_

PDB Entry: 3dzw, 1.7 Å

PDB Description: structure of narcissus pseudonarcissus lectin complex with mannobiose at 1.7 a resolution, form ii

PDB Compounds: (B:) agglutinin

SCOPe Domain Sequences for d3dzwb_:

Sequence; same for both SEQRES and ATOM records:

>d3dzwb_ b.78.1.1 (B:) Lectin (agglutinin) {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]}
dnilysgetlspgeflnngryvfimqedcnlvlydvdkpiwatntggldrrchlsmqsdg
nlvvysprnnpiwasntggengnyvcvlqkdrnvviygtarwatgtnih

Timeline for d3dzwb_:

• d3dzwb_ first appeared in SCOPe 2.01
  
• d3dzwb_ appears in SCOPe 2.05
  
• d3dzwb_ appears in SCOPe 2.07
  
• d3dzwb_ appears in the current release, SCOPe 2.08