Class b: All beta proteins [48724] (176 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins) |
Protein Lectin (agglutinin) [51112] (4 species) |
Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [51115] (2 PDB entries) |
Domain d3dzwb_: 3dzw B: [174418] automated match to d1npla_ complexed with po4 |
PDB Entry: 3dzw (more details), 1.7 Å
SCOPe Domain Sequences for d3dzwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dzwb_ b.78.1.1 (B:) Lectin (agglutinin) {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]} dnilysgetlspgeflnngryvfimqedcnlvlydvdkpiwatntggldrrchlsmqsdg nlvvysprnnpiwasntggengnyvcvlqkdrnvviygtarwatgtnih
Timeline for d3dzwb_: