Lineage for d3dzpa_ (3dzp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778007Protein automated matches [190195] (6 species)
    not a true protein
  7. 2778020Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)
  8. 2778040Domain d3dzpa_: 3dzp A: [174415]
    automated match to d1rqwa_
    complexed with tla

Details for d3dzpa_

PDB Entry: 3dzp (more details), 1.51 Å

PDB Description: Thaumatin by LB nanotemplate method after high X-Ray dose on ESRF ID29 beamline
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d3dzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dzpa_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d3dzpa_:

Click to download the PDB-style file with coordinates for d3dzpa_.
(The format of our PDB-style files is described here.)

Timeline for d3dzpa_: