SCOPe 2.01: Domain d3dz8a_: 3dz8 A:

Lineage for d3dz8a_ (3dz8 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (67 PDB entries)

8. Domain d3dz8a_: 3dz8 A: [174397]
   automated match to d1zbda_
   complexed with gdp, unx

Details for d3dz8a_

PDB Entry: 3dz8, 1.9 Å

PDB Description: crystal structure of human rab3b gtpase bound with gdp

PDB Compounds: (A:) Ras-related protein Rab-3B

SCOPe Domain Sequences for d3dz8a_:

Sequence; same for both SEQRES and ATOM records:

>d3dz8a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
renlyfqgnfdymfklliignssvgktsflfryaddtftpafvstvgidfkvktvyrhek
rvklqiwdtagqeryrtittayyrgamgfilmyditneesfnavqdwatqiktyswdnaq
vilvgnkcdmeeervvptekgqllaeqlgfdffeasakenisvrqaferlvdaicdkm

Timeline for d3dz8a_:

• d3dz8a_ is new in SCOPe 2.01-stable
  
• d3dz8a_ appears in SCOPe 2.02
  
• d3dz8a_ appears in the current release, SCOPe 2.08, called d3dz8a1