SCOPe 2.06: Domain d3dyra1: 3dyr A:2-109

Lineage for d3dyra1 (3dyr A:2-109)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli K-12 [TaxId:83333] [311109] (2 PDB entries)

8. Domain d3dyra1: 3dyr A:2-109 [174393]
   Other proteins in same PDB: d3dyra2, d3dyra3
   automated match to d1xoaa_
   mutant

Details for d3dyra1

PDB Entry: 3dyr, 2 Å

PDB Description: crystal structure of e. coli thioredoxin mutant i76t in its oxidized form

PDB Compounds: (A:) Thioredoxin-1

SCOPe Domain Sequences for d3dyra1:

Sequence; same for both SEQRES and ATOM records:

>d3dyra1 c.47.1.1 (A:2-109) Thioredoxin {Escherichia coli K-12 [TaxId: 83333]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgtptlllfkngevaatkvgalskgqlkefldanla

Timeline for d3dyra1:

• d3dyra1 first appeared in SCOPe 2.01, called d3dyra_
  
• d3dyra1 was called d3dyra_ in SCOPe 2.05
  
• d3dyra1 appears in SCOPe 2.07
  
• d3dyra1 appears in the current release, SCOPe 2.08