Lineage for d1para_ (1par A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325751Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 2325752Protein Arc repressor [47600] (1 species)
  7. 2325753Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 2325766Domain d1para_: 1par A: [17437]
    protein/DNA complex

Details for d1para_

PDB Entry: 1par (more details), 2.6 Å

PDB Description: dna recognition by beta-sheets in the arc repressor-operator crystal structure
PDB Compounds: (A:) protein (arc repressor)

SCOPe Domain Sequences for d1para_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1para_ a.43.1.1 (A:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegrig

SCOPe Domain Coordinates for d1para_:

Click to download the PDB-style file with coordinates for d1para_.
(The format of our PDB-style files is described here.)

Timeline for d1para_: